Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIN/DLC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	PIN/DLC8
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154949 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154949	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PIN/DLC8 Polyclonal specifically detects PIN/DLC8 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PIN/DLC8
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	p53 Pathway
Gene Alias	cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase
Gene Symbols	DYNLL1
Isotype	IgG
Molecular Weight of Antigen	10 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P63167
Gene ID (Entrez)	8655
Immunogen	Synthetic peptides corresponding to DYNLL1(dynein, light chain, LC8-type 1) The peptide sequence was selected from the N terminal of DYNLL1. Peptide sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PIN/DLC8 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents