Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIN/DLC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIN/DLC8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIN/DLC8 Polyclonal specifically detects PIN/DLC8 in Human samples. It is validated for Western Blot.Specifications
PIN/DLC8 | |
Polyclonal | |
Rabbit | |
p53 Pathway | |
cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase | |
DYNLL1 | |
IgG | |
10 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P63167 | |
8655 | |
Synthetic peptides corresponding to DYNLL1(dynein, light chain, LC8-type 1) The peptide sequence was selected from the N terminal of DYNLL1. Peptide sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title