Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pin1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32134025UL
Description
Pin1 Polyclonal antibody specifically detects Pin1 in Human samples. It is validated for ImmunofluorescenceSpecifications
Pin1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
dod, EC 5.2.1.8, peptidyl-prolyl cis/trans isomerase, NIMA-interacting, peptidylprolyl cis/trans isomerase, NIMA-interacting 1, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, prolyl isomerase, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1, Rotamase Pin1, UBL5 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR | |
25 μg | |
Cell Cycle and Replication, Mitotic Regulators, Phospho Specific | |
5300 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction