PINCH1/LIMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256112

Catalog No. NBP256112

Description

PINCH1/LIMS1 Polyclonal specifically detects PINCH1/LIMS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PINCH1/LIMS1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: LIM and senescent cell antigen-like domains 1, LIM and senescent cell antigen-like-containing domain protein 1, PINCH-1, PINCHPINCH1Particularly interesting new Cys-His protein 1, Renal carcinoma antigen NY-REN-48
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3987
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: LIMS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only