Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIP5K2 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PIP5K2 alpha |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIP5K2 alpha Polyclonal specifically detects PIP5K2 alpha in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PIP5K2 alpha | |
Polyclonal | |
Rabbit | |
Human | |
1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform | |
PIP4K2A | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5305 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title