Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIST Antibody, Novus Biologicals™
SDP

Catalog No. NBP155206 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155206 100 μL
NBP15520620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155206 Supplier Novus Biologicals Supplier No. NBP155206
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PIST Polyclonal specifically detects PIST in Human samples. It is validated for Western Blot.

Specifications

Antigen PIST
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein
Gene Symbols GOPC
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57120
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.