Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIWIL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIWIL4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIWIL4 Polyclonal specifically detects PIWIL4 in Human samples. It is validated for Western Blot.Specifications
PIWIL4 | |
Polyclonal | |
Rabbit | |
Human | |
DKFZp686P01248, FLJ36156, HIWI2MIWI2, Miwi2, PIWI, piwi-like 4 (Drosophila), piwi-like protein 4 | |
PIWIL4 | |
IgG | |
96 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q7Z3Z4 | |
143689 | |
Synthetic peptide directed towards the N terminal of human PIWIL4 (NP_689644). Peptide sequence SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title