Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIWIL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PIWIL4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154343
|
Novus Biologicals
NBP154343 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PIWIL4 Polyclonal specifically detects PIWIL4 in Human samples. It is validated for Western Blot.Specifications
| PIWIL4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q7Z3Z4 | |
| 143689 | |
| Synthetic peptide directed towards the N terminal of human PIWIL4 (NP_689644). Peptide sequence SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686P01248, FLJ36156, HIWI2MIWI2, Miwi2, PIWI, piwi-like 4 (Drosophila), piwi-like protein 4 | |
| PIWIL4 | |
| IgG | |
| Affinity Purified | |
| 96 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title