PJA2/Praja2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256901

Catalog No. NBP256901

Description

PJA2/Praja2 Polyclonal specifically detects PJA2/Praja2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PJA2/Praja2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: E3 ubiquitin-protein ligase Praja-2, EC 6.3.2, EC 6.3.2.-, KIAA0438praja2, Neurodap1, praja ring finger 2, Praja2, RING finger protein 131praja 2, RING-H2 motif containing, RNF131
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PJA2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRW
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 9867
• Target Species: Human
• Isotype: IgG

For Research Use Only