PKC eta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174117

Catalog No. NBP174117

Description

PKC eta Polyclonal specifically detects PKC eta in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PKC eta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.13, nPKC-eta, PKCLMGC26269, PKC-LMGC5363, PRKCLprotein kinase C eta type, protein kinase C, eta
• Host Species: Rabbit
• Molecular Weight of Antigen: 75 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P23298
• Gene Symbols: PRKCH
• Immunogen: Synthetic peptides corresponding to the C terminal of Prkch. Immunizing peptide sequence TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5583
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only