PKC gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238569

Catalog No. NBP238569

Description

PKC gamma Polyclonal specifically detects PKC gamma in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PKC gamma
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P05129
• Gene Symbols: PRKCG
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
• Quantity: 0.1 mL
• Research Discipline: Protein Kinase, Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 5582
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.13, MGC57564, PKCCSCA14, PKC-gamma, PKCGprotein kinase C gamma type, protein kinase C, gamma
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.