PKI-beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174255

Catalog No. NBP174255

Description

PKI-beta Polyclonal specifically detects PKI-beta in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: PKI-beta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cAMP-dependent protein kinase inhibitor 2, cAMP-dependent protein kinase inhibitor beta, FLJ23817, PKI-beta, PRKACN2, protein kinase (cAMP-dependent, catalytic) inhibitor beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 12 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5570
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8R4R3
• Gene Symbols: PKIB
• Immunogen: Synthetic peptides corresponding to the middle region of Pkib. Immunizing peptide sequence TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Goat: 85%.
• Target Species: Mouse, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG