Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLA2G12B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23168525UL
Description
PLA2G12B Polyclonal specifically detects PLA2G12B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PLA2G12B | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9BX93 | |
PLA2G12B | |
This antibody was developed against a recombinant protein corresponding to amino acids: DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM | |
25 μL | |
Lipid and Metabolism | |
84647 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
group XIIB secretory phospholipase A2-like protein, group XIII secreted phospholipase A2, Group XIII secretory phospholipase A2-like protein, GXIIBMGC138151, GXIII sPLA2-like, GXIIIsPLA2, phospholipase A2, group XIIB, phospholipase A2, group XIII, PLA2G13, sPLA2-GXIIB | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction