Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PLA2R1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 8 publications

Supplier:  Novus Biologicals NBP184449

 View more versions of this product

Catalog No. NBP184449


Only null left
Add to Cart

Description

Description

PLA2R1 Polyclonal specifically detects PLA2R1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

PLA2R1
Polyclonal
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Q13018
PLA2R1
This antibody was developed against Recombinant Protein corresponding to amino acids:EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
180 kDa secretory phospholipase A2 receptor, CLEC13CC-type lectin domain family 13 member C, phospholipase A2 receptor 1, 180kDa, PLA2G1R, PLA2IR, PLA2-RM-type receptor, PLA2Rphospholipase A2 receptor 1, 180kD, secretory phospholipase A2 receptor
Rabbit
Affinity Purified
RUO
22925
Human
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only