PLC-beta 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP238220	Novus Biologicals NBP238220	0.1 mL
NB436275	Novus Biologicals NBP23822025UL	25 μL

Description

PLC-beta 1 Polyclonal specifically detects PLC-beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLC-beta 1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q9NQ66
• Gene ID (Entrez): 23236
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism, Wnt Signaling Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.4.11, EIEE12, FLJ45792, inositoltrisphosphohydrolase, KIAA05811-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1, monophosphatidylinositol phosphodiesterase, phosphoinositidase C, Phosphoinositide phospholipase C-beta-1, phospholipase C, beta 1 (phosphoinositide-specific), Phospholipase C-beta-1, Phospholipase C-I, PI-PLC, PLC-154, PLC154,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1, PLCB1A, PLCB1B, PLC-beta-1, PLC-I1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase
• Gene Symbols: PLCB1
• Isotype: IgG
• Purification Method: Affinity Purified