Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLC-beta 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PLC-beta 1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PLC-beta 1 Polyclonal specifically detects PLC-beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PLC-beta 1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q9NQ66 | |
23236 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism, Wnt Signaling Pathway | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 3.1.4.11, EIEE12, FLJ45792, inositoltrisphosphohydrolase, KIAA05811-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1, monophosphatidylinositol phosphodiesterase, phosphoinositidase C, Phosphoinositide phospholipase C-beta-1, phospholipase C, beta 1 (phosphoinositide-specific), Phospholipase C-beta-1, Phospholipase C-I, PI-PLC, PLC-154, PLC154,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1, PLCB1A, PLCB1B, PLC-beta-1, PLC-I1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase | |
PLCB1 | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title