PLC-gamma 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238317

Catalog No. NBP238317

Description

PLC-gamma 1 Polyclonal specifically detects PLC-gamma 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLC-gamma 1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P19174
• Gene Symbols: PLCG1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNG
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 5335
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.4.11, gamma 1 (formerly subtype 148), monophosphatidylinositol phosphodiesterase, NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1, phosphatidylinositol phospholipase C, phosphoinositidase C, phosphoinositide phospholipase C, Phosphoinositide phospholipase C-gamma-1, phospholipase C, gamma 1, phospholipase C-148, Phospholipase C-gamma-1, Phospholipase C-II, PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1, PLC148, PLC-148, PLC-gamma-1, PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.