Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLC-gamma 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$274.85 - $530.46
Specifications
| Antigen | PLC-gamma 1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PLC-gamma 1 Polyclonal specifically detects PLC-gamma 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PLC-gamma 1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.1.4.11, gamma 1 (formerly subtype 148), monophosphatidylinositol phosphodiesterase, NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1, phosphatidylinositol phospholipase C, phosphoinositidase C, phosphoinositide phospholipase C, Phosphoinositide phospholipase C-gamma-1, phospholipase C, gamma 1, phospholipase C-148, Phospholipase C-gamma-1, Phospholipase C-II, PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1, PLC148, PLC-148, PLC-gamma-1, PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase | |
| PLCG1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P19174 | |
| 5335 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title