Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLC-gamma 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PLC-gamma 1 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PLC-gamma 1 Polyclonal specifically detects PLC-gamma 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PLC-gamma 1 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism, Signal Transduction | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 3.1.4.11, gamma 1 (formerly subtype 148), monophosphatidylinositol phosphodiesterase, NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1, phosphatidylinositol phospholipase C, phosphoinositidase C, phosphoinositide phospholipase C, Phosphoinositide phospholipase C-gamma-1, phospholipase C, gamma 1, phospholipase C-148, Phospholipase C-gamma-1, Phospholipase C-II, PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1, PLC148, PLC-148, PLC-gamma-1, PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase | |
PLCG1 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P19174 | |
5335 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title