Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PLC-gamma 1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200075797 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238317 0.1 mL
NB436244 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238317 Supplier Novus Biologicals Supplier No. NBP238317
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PLC-gamma 1 Polyclonal specifically detects PLC-gamma 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PLC-gamma 1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P19174
Gene Alias EC 3.1.4.11, gamma 1 (formerly subtype 148), monophosphatidylinositol phosphodiesterase, NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1, phosphatidylinositol phospholipase C, phosphoinositidase C, phosphoinositide phospholipase C, Phosphoinositide phospholipase C-gamma-1, phospholipase C, gamma 1, phospholipase C-148, Phospholipase C-gamma-1, Phospholipase C-II, PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1, PLC148, PLC-148, PLC-gamma-1, PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase
Gene Symbols PLCG1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNG
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5335
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.