PLCL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21376825UL

Catalog No. NB438300

Description

PLCL2 Polyclonal specifically detects PLCL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLCL2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 3.1.4.11, FLJ13484, inactive phospholipase C-like protein 2, KIAA1092PLCE2, phospholipase C, epsilon 2, Phospholipase C-epsilon-2, Phospholipase C-L2, phospholipase C-like 2, PLC-epsilon-2, PLC-L(2), PLC-L2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23228
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PLCL2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIE
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only