PLEKHA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397527	Novus Biologicals NBP23201825UL	25 μL
NBP232018	Novus Biologicals NBP232018	0.1 mL

Description

PLEKHA3 Polyclonal specifically detects PLEKHA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLEKHA3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FAPP-1, FAPP1PH domain-containing family A member 3, FLJ20067, four-phosphate-adaptor protein 1, Phosphatidylinositol-four-phosphate adapter protein 1, Phosphoinositol 4-phosphate adapter protein 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3, pleckstrin homology domain-containing family A member 3, pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3
• Gene Symbols: PLEKHA3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9HB20
• Gene ID (Entrez): 65977
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only