Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PLEKHG3 Antibody, Novus Biologicals™

PLEKHG3 Antibody, Novus Biologicals™
SDP

Catalog No. p-200060351 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392797 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392797 Supplier Novus Biologicals Supplier No. NBP26898625UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PLEKHG3 Polyclonal antibody specifically detects PLEKHG3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PLEKHG3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias ARHGEF43, KIAA0599, PH Domain-Containing Family G Member 3, Pleckstrin Homology And RhoGEF Domain Containing G3, Pleckstrin Homology Domain Containing, Family G, Member 3, Pleckstrin Homology Domain-Containing Family G Member 3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26030
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.