Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLEKHO2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310197100UL
Description
PLEKHO2 Polyclonal specifically detects PLEKHO2 in Mouse samples. It is validated for Western Blot.Specifications
PLEKHO2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DKFZp761K2312, FLJ38884, PH domain-containing family O member 2, PH domain-containing family Q member 1, PH domain-containing protein, pleckstrin homology domain containing, family O member 2, pleckstrin homology domain containing, family Q member 1, pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1, PLEKHQ1, PP1628, pp9099 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse PLEKHO2 (NP_694759.1). Peptide sequence LLRSPGNKVSDIKFQAPSGEEKESWIKALNEGINRGKNKAFDEVKVDKTC | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
80301 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction