Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PLZF Antibody, Novus Biologicals™

PLZF Antibody, Novus Biologicals™
SDP

Catalog No. NBP180894 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180894 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180894 Supplier Novus Biologicals Supplier No. NBP180894
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

PLZF Polyclonal specifically detects PLZF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen PLZF
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Concentration 0.1mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen -Reported in scientific literature (PMID: 31145102).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q05516, Q05516, Q05516, Q05516
Gene Alias PLZFzinc finger and BTB domain-containing protein 16, zinc finger and BTB domain containing 16, Zinc finger protein 145, zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia), Zinc finger protein PLZF, ZNF145Promyelocytic leukemia zinc finger protein
Gene Symbols ZBTB16
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Innate Immunity, Neuronal Stem Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 7704
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.