Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PMCA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23198425UL
Description
PMCA4 Polyclonal specifically detects PMCA4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PMCA4 | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
P23634 | |
ATP2B4 | |
This antibody was developed against a recombinant protein corresponding to amino acids: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ATP2B2plasma membrane calcium ATPase, ATPase, Ca++ transporting, plasma membrane 4, DKFZp686G08106, DKFZp686M088, EC 3.6.3, EC 3.6.3.8, Matrix-remodeling-associated protein 1, matrix-remodelling associated 1, MXRA1, Plasma membrane calcium ATPase isoform 4, plasma membrane calcium pump, Plasma membrane calcium pump isoform 4, plasma membrane calcium-transporting ATPase 4, PMCA4b, PMCA4PMCA4x, sarcolemmal calcium pump | |
Rabbit | |
Affinity Purified | |
RUO | |
493 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction