Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ PMEL Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595605
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595605 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595605 Supplier Invitrogen™ Supplier No. PA595605
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, mouse heart tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Melanoma is a malignant tumor of melanocytes which are found predominantly in skin but also in the bowel and the eye (see uveal melanoma). It is one of the rarer types of skin cancer but causes the majority of skin cancer related deaths.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PMEL
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene PMEL
Gene Accession No. P40967, Q60696
Gene Alias 95 kDa melanocyte-specific secreted glycoprotein; 95kDa melanocyte-specific secreted glycoprotein; D10H12S53E; D12S53E; D12S53Eh; gp100; gp87; M-alpha; M-beta; ME20; ME20M; ME20-M; ME20-S; Melanocyte lineage specific antigen GP100; melanocyte protein mel 17; melanocyte protein PMEL; Melanocyte protein Pmel 17; melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; melanosomal matrix protein17; P1; P100; P26; PMEL; Pmel 17; PMEL17; premelanosome protein; Secreted melanoma-associated ME20 antigen; SI; SIL; SILV; silver homolog; silver locus protein; silver locus protein homolog; silver, mouse, homolog of
Gene Symbols PMEL
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20431, 362818, 6490
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.