PMEL17/SILV Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169571

Catalog No. NBP169571

Description

PMEL17/SILV Polyclonal antibody specifically detects PMEL17/SILV in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin).

Specifications

• Antigen: PMEL17/SILV
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: D12S53EP1, gp100, ME20, ME20-M, melanocyte protein mel 17, Melanocyte protein Pmel 17, Melanocytes lineage-specific antigen GP100, Melanoma-associated ME20 antigen, melanosomal matrix protein17, PMEL17P100, premelanosome proteinME20M, SI, SIL, silver (mouse homolog) like, silver homolog (mouse), Silver locus protein homolog, silver, mouse, homolog of, SILVPmel17
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1.25 ug/ml
• Gene Accession No.: P40967
• Gene Symbols: PMEL
• Immunogen: Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6490
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only