Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PML Protein Antibody, Novus Biologicals™
SDP

Catalog No. NBP187783 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP187783 0.1 mL
NB418530 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP187783 Supplier Novus Biologicals Supplier No. NBP187783
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 3 publications

PML Protein Polyclonal specifically detects PML Protein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PML Protein
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias MYLPP8675, promyelocytic leukemia, Promyelocytic leukemia protein, RING finger protein 71, RNF71probable transcription factor PML, TRIM19promyelocytic leukemia, inducer of, tripartite motif protein TRIM19, Tripartite motif-containing protein 19
Gene Symbols PML
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 5371
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.