Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PMM1/Phosphomannomutase 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | PMM1/Phosphomannomutase 1 |
---|---|
Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
Applications | Western Blot, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PMM1/Phosphomannomutase 1 Polyclonal antibody specifically detects PMM1/Phosphomannomutase 1 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
PMM1/Phosphomannomutase 1 | |
Western Blot, Immunofluorescence | |
Unconjugated | |
Rabbit | |
Proteases & Other Enzymes | |
PBS, pH 7.2, 40% glycerol | |
5372 | |
IgG | |
Affinity purified |
Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: YCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title