PNCK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18665225UL

Catalog No. NB431796

Description

PNCK Polyclonal specifically detects PNCK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PNCK
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: BSTK3, calcium/calmodulin-dependent protein kinase type 1B, CaM kinase I beta, CaM kinase IB, CaMK1b, CaM-KI beta, CaMKI-beta, EC 2.7.11, EC 2.7.11.17, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419, pregnancy up-regulated non-ubiquitously expressed CaM kinase, pregnancy upregulated non-ubiquitously expressed CaM kinase, Pregnancy up-regulated non-ubiquitously-expressed CaM kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunofluorescence, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PNCK
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 139728
• Target Species: Human
• Isotype: IgG

For Research Use Only