Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PNKD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | PNKD |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PNKD Polyclonal specifically detects PNKD in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
PNKD | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
25953 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated | |
Polyclonal | |
Rabbit | |
Human, Mouse | |
BRP17FKSG19, DKFZp564N1362, DYT8paroxysmal nonkinesiogenic dyskinesia, FPD1brain protein 17, KIAA1184Myofibrillogenesis regulator 1, KIPP1184probable hydrolase PNKD, MGC31943, MR1Paroxysmal nonkinesiogenic dyskinesia protein, MR-1Trans-activated by hepatitis C virus core protein 2, paroxysmal nonkinesigenic dyskinesia, PDCEC 3.-, TAHCCP2PKND1 | |
PNKD | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title