Learn More
Description
Specifications
Specifications
| Antigen | PNKD |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | BRP17FKSG19, DKFZp564N1362, DYT8paroxysmal nonkinesiogenic dyskinesia, FPD1brain protein 17, KIAA1184Myofibrillogenesis regulator 1, KIPP1184probable hydrolase PNKD, MGC31943, MR1Paroxysmal nonkinesiogenic dyskinesia protein, MR-1Trans-activated by hepatitis C virus core protein 2, paroxysmal nonkinesigenic dyskinesia, PDCEC 3.-, TAHCCP2PKND1 |
| Gene Symbols | PNKD |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:REVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQSAPSPDVGSGVQ |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
