Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. Novus Biologicals™ PNMA6A Recombinant Protein Antigen

Novus Biologicals™ PNMA6A Recombinant Protein Antigen
SDP

Catalog No. NBP246708X Shop All R&D Systems Products
Change view
Click to view available options
Protein Length:
GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Protein Length
NBP246708X GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
NBP246800X IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP246708X Supplier Novus Biologicals™ Supplier No. NBP246708PEP
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PNMA6A The PNMA6A Recombinant Protein Antigen is derived from E. coli. The PNMA6A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Protein Length GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
Purity >80% by SDS-PAGE and Coomassie blue staining
Common Name PNMA6A Recombinant Protein Antigen
Content And Storage Store at −20°C short term. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) AC
Gene Alias MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6
Gene Symbol PNMA6A
Label Type Unlabeled
Molecular Weight (g/mol) 26 kDa
Product Type Recombinant Protein Antigen
Quantity 0.1 mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.