Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POFUT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | POFUT2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15805320
![]() |
Novus Biologicals
NBP15805320UL |
20 μL |
Each for $206.00
|
|
|||||
NBP158053
![]() |
Novus Biologicals
NBP158053 |
100 μL |
Each for $487.50
|
|
|||||
Description
POFUT2 Polyclonal specifically detects POFUT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
POFUT2 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
C21orf80, chromosome 21 open reading frame 80, FUT13EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, O-FucT-2, Peptide-O-fucosyltransferase 2, protein O-fucosyltransferase 2 | |
POFUT2 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
Q9Y2G5-1 | |
23275 | |
Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the C terminal of POFUT2. Peptide sequence RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title