Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Pokemon Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580247
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580247 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580247 Supplier Invitrogen™ Supplier No. PA580247
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell. IHC: human intestinal cancer tissue. ICC/IF: A431 cell. Flow: MCF-7 cell.

Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pokemon
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene ZBTB7A
Gene Accession No. O95365
Gene Alias 9030619K07Rik; 9130006G12Rik; AI452336; cLRF; DKFZp547O146; factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI1; FBI-1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; leukemia/lymohoma related factor cLRF; leukemia/lymphoma related factor; leukemia/lymphoma related factor cLRF; leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; Oczf; Osteoclast-derived zinc finger protein; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; Zbtb7; ZBTB7A; zi; zinc finger and BTB domain containing 7a; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A; ZNF857A
Gene Symbols ZBTB7A
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51341
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.