POLDIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180103

Catalog No. NBP180103

Description

POLDIP1 Polyclonal specifically detects POLDIP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLDIP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BACURD1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, hBACURD1, PDIP1FKSG86, POLDIP1TNFAIP1-like protein, Polymerase delta-interacting protein 1, potassium channel tetramerisation domain containing 13
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_849194
• Gene Symbols: KCTD13
• Immunogen: Synthetic peptide directed towards the N terminal of human KCTD13. Peptide sequence PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 253980
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only