Learn More
Invitrogen™ POLI Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA595515
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human A549 whole cell, human SK-OV-3 whole cell, rat testis tissue, rat testis tissue, rat kidney tissue, rat stomach tissue, mouse testis tissue, mouse testis tissue, mouse kidney tissue, mouse stomach tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity.
Specifications
POLI | |
Polyclonal | |
Unconjugated | |
Poli | |
DNA polymerase iota; eta2; Poli; polymerase (DNA directed) iota; polymerase (DNA directed), iota; polymerase (DNA) iota; polymerase (DNA-directed), iota; RAD 30B; RAD30; RAD30 homolog B; RAD30B; RAD3OB | |
Rabbit | |
Affinity chromatography | |
RUO | |
11201, 26447, 291526 | |
-20°C | |
Lyophilized |
Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
Q6R3M4, Q9UNA4 | |
Poli | |
A synthetic peptide corresponding to a sequence of human DNA Polymerase iota (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.