Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR1D Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | POLR1D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152917
|
Novus Biologicals
NBP152917 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
POLR1D Polyclonal specifically detects POLR1D in Human samples. It is validated for Western Blot.Specifications
| POLR1D | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| AC19, DNA-directed RNA polymerase I subunit D, DNA-directed RNA polymerases I and III subunit RPAC2, FLJ20616, hRPA19, MGC9850, POLR1C, polymerase (RNA) I polypeptide D, 16kDa, RPA16RNA polymerase I 16 kDa subunit, RPA9, RPAC2RNA polymerases I and III subunit AC2, RPC16, RPO1-3, TCS2 | |
| POLR1D | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: RPAC2. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y2S0 | |
| 51082 | |
| Synthetic peptides corresponding to POLR1D(polymerase (RNA) I polypeptide D, 16kDa) The peptide sequence was selected from the middle region of POLR1D. Peptide sequence TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title