Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR2C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180817
Description
POLR2C Polyclonal specifically detects POLR2C in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
POLR2C | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
P19387 | |
POLR2C | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ | |
0.1 mL | |
DNA Repair, DNA replication Transcription Translation and Splicing | |
5432 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DNA-directed RNA polymerase II 33 kDa polypeptide, DNA-directed RNA polymerase II subunit C, DNA-directed RNA polymerase II subunit RPB3, hRPB33, hsRPB3, polymerase (RNA) II (DNA directed) polypeptide C (33kD), polymerase (RNA) II (DNA directed) polypeptide C, 33kDa, RNA polymerase II subunit 3, RNA polymerase II subunit B3, RPB3, RPB31, RPB33 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction