POLR3GL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18199725UL

Catalog No. NB433529

Description

POLR3GL Polyclonal specifically detects POLR3GL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR3GL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9BT43
• Gene Symbols: POLR3GL
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alternative RNA polymerase III subunit 32, DNA-directed RNA polymerase III subunit G-like, DNA-directed RNA polymerase III subunit RPC7-like, flj32422, FLJ34890, MGC3200, polymerase (RNA) III (DNA directed) polypeptide G (32kD) like, polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like, RNA polymerase III subunit C7-like, RPC32HOM, RPC32-like protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84265
• Target Species: Human
• Isotype: IgG

For Research Use Only