Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POMC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | POMC |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
POMC Polyclonal specifically detects POMC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| POMC | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein | |
| POMC | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Nutrient Sensing in the Brain | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5443 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title