Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POMGNT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C3orf39 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
POMGNT2 Polyclonal specifically detects POMGNT2 in Human samples. It is validated for Western Blot.Specifications
C3orf39 | |
Polyclonal | |
Purified | |
RUO | |
AGO61, C3orf39, chromosome 3 open reading frame 39, EC 2.4, FLJ14566, glycosyltransferase, glycosyltransferase-like domain containing 2, MDDGA8 | |
GTDC2 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_116195 | |
84892 | |
Synthetic peptide directed towards the middle region of human C3orf39The immunogen for this antibody is C3ORF39. Peptide sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title