Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POMK/SGK196 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
POMK/SGK196 Polyclonal specifically detects POMK/SGK196 in Human, Mouse samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
FLJ23356, MGC126597, protein kinase-like protein SgK196, Sugen kinase 196 | |
Synthetic peptides corresponding to FLJ23356(hypothetical protein FLJ23356) The peptide sequence was selected from the N terminal of FLJ23356. Peptide sequence CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL. | |
Primary |
Polyclonal | |
Rabbit | |
Protein Kinase | |
84197 | |
IgG | |
40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title