POT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25789125UL

Catalog No. NB393730

Description

POT1 Polyclonal specifically detects POT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: POT1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp586D211, hPot1, POT1 protection of telomeres 1 homolog, POT1-like telomere end-binding protein, protection of telomeres 1 homolog (S. pombe), protection of telomeres protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: POT1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
• Quantity: 25 μL
• Research Discipline: Cancer, Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 25913
• Target Species: Human
• Isotype: IgG

For Research Use Only