Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POU3F2/OCT7 Antibody (CL6228), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $610.00
Specifications
Antigen | POU3F2/OCT7 |
---|---|
Clone | CL6228 |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
POU3F2/OCT7 Monoclonal specifically detects POU3F2/OCT7 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
POU3F2/OCT7 | |
Monoclonal | |
Purified | |
Transcription Factors and Regulators | |
5454 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
CL6228 | |
Unconjugated | |
Mouse | |
Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3 | |
POU3F2 | |
IgG1 | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title