POU3F2/OCT7 Antibody (CL6232), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP26143725UL

Catalog No. NB393101

Description

POU3F2/OCT7 Monoclonal specifically detects POU3F2/OCT7 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POU3F2/OCT7
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: POU3F2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
• Quantity: 25 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 5454
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: CL6232
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1