PP4/PPP4C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213802

Catalog No. NBP213802

Description

PP4/PPP4C Polyclonal specifically detects PP4/PPP4C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP4C
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: EC 3.1.3.16, Pp4, PP4C, PP4protein phosphatase X, catalytic subunit, PPP4, PP-X, PPXPPH3, protein phosphatase 4 (formerly X), catalytic subunit, protein phosphatase 4, catalytic subunit, Protein phosphatase X, serine/threonine-protein phosphatase 4 catalytic subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP4C
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCG
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Protein Phosphatase, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 5531
• Target Species: Human
• Isotype: IgG

For Research Use Only