Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPEF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PPEF2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PPEF2 Polyclonal specifically detects PPEF2 in Human samples. It is validated for Western Blot.Specifications
PPEF2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Vision | |
PBS buffer, 2% sucrose | |
5470 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
protein phosphatase 7, catalytic subunit, beta isozyme, protein phosphatase with EF hands 2, protein phosphatase, EF hand calcium-binding domain 2, protein phosphatase, EF-hand calcium binding domain 2, serine/threonine-protein phosphatase with EF-hands 2 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPEF2 (NP_006230). Peptide sequence LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title