Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPFIA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | PPFIA4 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PPFIA4 Polyclonal specifically detects PPFIA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PPFIA4 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
None | |
8497 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KIAA0897, liprin alpha4, liprin-alpha-4, Liprin-alpha4, Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4, protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4, PTPRF-interacting protein alpha-4 | |
PPFIA4 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title