PPIH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232416

Catalog No. NBP232416

Description

PPIH Polyclonal specifically detects PPIH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPIH
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: cyclophilin H, CYP20, CypH, CYPHpeptidyl prolyl isomerase H (cyclophilin H), EC 5.2.1.8, MGC5016, peptidyl-prolyl cis-trans isomerase H, peptidylprolyl isomerase H (cyclophilin H), PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, USA-CyP SnuCyp-20, USA-CYPCYP-20, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPIH
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10465
• Target Species: Human
• Isotype: IgG

For Research Use Only