Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPIL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PPIL2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154366
|
Novus Biologicals
NBP154366 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PPIL2 Polyclonal specifically detects PPIL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PPIL2 | |
| Unconjugated | |
| RUO | |
| Q13356 | |
| 23759 | |
| Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CYC4, cyclophilin, 60kDa, cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, CYP60, EC 5.2.1.8, FLJ39930, hCyP-60, MGC33174, MGC787, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase-like 2, peptidylprolyl isomerase (cyclophilin)-like 2, PPIase, Rotamase PPIL2 | |
| PPIL2 | |
| IgG | |
| Affinity Purified | |
| 59 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title