Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPM1K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | PPM1K |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PPM1K Polyclonal specifically detects PPM1K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PPM1K | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| DKFZp667B084, DKFZp761G058, mitochondrial, PP2C domain-containing protein phosphatase 1K, PP2Ckappa, PP2C-like mitochondrial protein, PP2Cm, PP2C-type mitochondrial phosphoprotein phosphatase, protein phosphatase 2C kappa, protein phosphatase, Mg2+/Mn2+ dependent, 1K, PTMPEC 3.1.3.16 | |
| PPM1K | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 152926 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHAR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title